Tyam / Tyam - Tubo Y Acero De Monterrey

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Tyam - Tubo Y Acero De Monterrey
Description	Tubo Y Acero De Monterrey
Keywords	N/A

Server Information

WebSite	www.tyam.com.mx
Host IP	67.228.106.229
Location	Seattle, Washington, United States

Related Websites

Site	Rank
tecnotubos.com.mx	#3,345,349
pacusa.com.mx	#2,953,995

More to Explore

usavisamrvfeepaymentserviceinmexico.wordpress.com

vaguitos-co.myshopify.com

villamaria-caldas.gov.co

visiondelarte.blogspot.com

nugala.com

olivs.app

Tyam.com.mx Valuation

US$16,600

Last updated: Feb 6, 2021

Tyam.com.mx has global traffic rank of 1,032,738 and ranks the 16,220th in Mexico. Tyam.com.mx has an estimated worth of US$ 16,600, based on its estimated Ads revenue. Tyam.com.mx receives approximately 3,032 unique visitors each day. Its web server is located in Seattle, Washington, United States, with IP address 67.228.106.229. According to SiteAdvisor, tyam.com.mx is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$16,600
Daily Ads Revenue	US$9
Monthly Ads Revenue	US$272
Yearly Ads Revenue	US$3,320
Daily Unique Visitors	3,032
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	1,032,738
Delta (90 Days)	0
Most Popular In Country	Mexico
Country Rank	16,220

DNS Records

Host	Type	TTL	Data
tyam.com.mx	A	21599	IP: 67.228.106.229
tyam.com.mx	MX	21599	Priority: 10 Target: mail.tyam.com.mx.
tyam.com.mx	NS	21599	Target: ns2.tyam.com.mx.
tyam.com.mx	NS	21599	Target: ns1.tyam.com.mx.
tyam.com.mx	NS	21599	Target: ns.tyam.com.mx.
tyam.com.mx	TXT	21599	TXT: v=spf1 +a +mx +a:srv3.multicomp.com.mx ~all
tyam.com.mx	SOA	21599	MNAME: ns.tyam.com.mx. RNAME: ramontorres.tyam.com.mx. Serial: 1611897315 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 10800

HTTP Headers

HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Sat, 06 Feb 2021 14:22:32 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://tyam.com.mx/

HTTP/2 200 
server: nginx
date: Sat, 06 Feb 2021 14:22:34 GMT
content-type: text/html; charset=UTF-8
content-length: 15636
x-powered-by: PHP/7.3.26
link: <https://tyam.com.mx/wp-json/>; rel="https://api.w.org/"
x-powered-by: PleskLin

Tyam.com.mx Whois Information

Domain Name:       tyam.com.mx

Created On:        2007-03-13
Expiration Date:   2021-03-12
Last Updated On:   2020-03-26
Registrar:         Multicomp SA de CV
URL:               http://www.multicomp.com.mx

Registrant:
   Name:           Multicomp S.A. de C.V.
   City:           Monterrey
   State:          Nuevo Leon
   Country:        Mexico

Administrative Contact:
   Name:           Multicomp S.A. de C.V.
   City:           Monterrey
   State:          Nuevo Leon
   Country:        Mexico

Technical Contact:
   Name:           Multicomp S.A. de C.V.
   City:           Monterrey
   State:          Nuevo Leon
   Country:        Mexico

Billing Contact:
   Name:           Multicomp S.A. de C.V.
   City:           Monterrey
   State:          Nuevo Leon
   Country:        Mexico

Name Servers:
   DNS:            ns1.multicomp.com.mx       75.126.251.242
   DNS:            ns2.multicomp.com.mx       75.126.251.243

DNSSEC DS Records:

Tyam.com.mx valuation and analysis